PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G193800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 429aa    MW: 45492.5 Da    PI: 6.424
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G193800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS259.71e-79354252373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetsekn.sseelaalkl..fsevs 88 
                         ++lLl+cA a++s+d +laq++++ l+++as++gdp+qRl++ +++AL ar  r   +l++   +++e++  +  ++++++++l  +++++
  Sevir.3G193800.1.p  35 QQLLLHCAAALESNDVTLAQQAMWVLNNIASSQGDPNQRLTSWLLRALVARACR---QLCAPAgTTQEAAAVRpRERAVSVTELaeYVDLT 122
                         699**************************************************9...44444413333333333334444444467***** PP

                GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg...skeeleetgerLakfAeelgvp 175
                         P+++f++ + N+aIl+av+g+ +vH++D++++ ++QWp+L++ L++R++gpp  lRiT+ ++  ++        ee+g rLa+fA++ gv+
  Sevir.3G193800.1.p 123 PWHRFGFTASNSAILRAVAGSAAVHVVDLGVTRCMQWPTLIDMLSKRSGGPPaLLRITVPSARPTVpplLGVPDEELGVRLANFAKSKGVR 213
                         ************************************************8888789***99986666877777789**************** PP

                GRAS 176 fefnvl...................vakrledl.....eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvv 242
                         +efnv                        +++l     ++ +L+++ gEal+Vn++  + ++       +  rd++L++v+ l+P +v+v+
  Sevir.3G193800.1.p 214 LEFNVAgkgtgtspasspekaaaaaP---CQNLasvlsDPPSLALRDGEALVVNCQSWIRHVA------PGSRDAFLDAVRALNPCLVTVT 295
                         ****999999*999999998874442...33334446789999**************999997......555788**************** PP

                GRAS 243 eqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsek 332
                         +++ad++s+s++ r+  +l++++ lfd+l++++pr+s  r+  E++ +gr+i++vv +  a    er e+ ++  er+++ GF  v+++e+
  Sevir.3G193800.1.p 296 DEDADLDSPSLASRIEGCLNFHWILFDALDTSAPRDSPRRAEHEAA-VGRKIESVVGADDAGgGAERSESGARLAERMRRNGFAGVAFDEE 385
                         ********************************************99.*********998887689************************** PP

                GRAS 333 aakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                         +a ++++ll++++  g+ v+ e++ lvl+Wk++  v +SaW
  Sevir.3G193800.1.p 386 TAGEVRRLLSEHA-TGWGVKREEDMLVLTWKGHGAVYTSAW 425
                         *************.99************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.6438407IPR005202Transcription factor GRAS
PfamPF035143.6E-7735425IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MEQEMRTAAS GGGSGLRAHS SVCFSGALID GPRIQQLLLH CAAALESNDV TLAQQAMWVL  60
NNIASSQGDP NQRLTSWLLR ALVARACRQL CAPAGTTQEA AAVRPRERAV SVTELAEYVD  120
LTPWHRFGFT ASNSAILRAV AGSAAVHVVD LGVTRCMQWP TLIDMLSKRS GGPPALLRIT  180
VPSARPTVPP LLGVPDEELG VRLANFAKSK GVRLEFNVAG KGTGTSPASS PEKAAAAAPC  240
QNLASVLSDP PSLALRDGEA LVVNCQSWIR HVAPGSRDAF LDAVRALNPC LVTVTDEDAD  300
LDSPSLASRI EGCLNFHWIL FDALDTSAPR DSPRRAEHEA AVGRKIESVV GADDAGGGAE  360
RSESGARLAE RMRRNGFAGV AFDEETAGEV RRLLSEHATG WGVKREEDML VLTWKGHGAV  420
YTSAWMPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-26344254374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961603.10.0PREDICTED: scarecrow-like protein 32
TrEMBLK3Z6E80.0K3Z6E8_SETIT; Uncharacterized protein
STRINGSi022117m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122273238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.15e-99GRAS family protein